Overview¶
Creating Pdb objects¶
There are two main ways to create a Pdb object from a PDB file. The first is from a local PDB file:
>>> import molecupy
>>> pdb = molecupy.get_pdb_from_file("path/to/file.pdb")
This is the quickest way, though it is not always convenient to store PDB files locally. The second way is to fetch the PDB file over the internet:
>>> import molecupy
>>> pdb = molecup.get_pdb_remotely("1LOL")
This takes longer, but it means you can access any published PDB file without needing to manually download them first.
However the text of the PDB file is obtained, the process of parsing it is always the same:
1. First a
PdbFileobject is created, which is a representation of the file itself. This is essentially a list of records, with methods for getting records of a certain name.2. This is used to make a
PdbDataFileobject. This is the object which extracts the data from the file, and is essentially an unstructured list of values.3. This is used to make a
Pdbobject, by using the values in the data file to create a user-friendly handle to the information. This is the object returned by the above two methods.
Accessing Pdb properties¶
Aside from structural information, PDB files also contain many other pieces of information about the file, such as its title, experimental techniques used to create it, publication information etc.
>>> pdb.pdb_code()
'1LOL'
>>> pdb.deposition_date()
datetime.date(2002, 5, 6)
>>> pdb.authors()
['N.WU', 'E.F.PAI']
molecuPy is a reasonably forgiving parser. If records are missing from the PDB
file - even records which the PDB specification insists must be present - the
file will still parse, and any missing properties will just be set to None
or an empty list, whichever is appropriate.
Pdb Models¶
The heart of a Pdb is its model. A Model represents the
structure contained in that PDB file, and is the environment in which all other
molecules and structures are based.
All Pdb objects have a list of models, which in most cases will contain a single
model. Structures created from NMR will often have multiple models - each
containing the same structures but with slightly different coordinates. For ease
of use, all Pdb objects also have a model method, which points to the
first model in the list.
>>> pdb.models()
[<Model (3431 atoms)>]
>>> pdb.model()
<Model (3431 atoms)>
The Model class is an atomic structure (i.e. it inherits from
AtomicStructure) which means you can get certain atomic properties
directly from the model, such as mass, formula, and the atoms
themselves:
>>> pdb.model().mass()
20630.8656
>>> pdb.model().formula()
Counter({'C': 2039, 'O': 803, 'N': 565, 'S': 22, 'P': 2})
>>> len(pdb.model().atoms())
3431
>>> pdb.model().get_atoms_by_element("P")
{<PdbAtom 3200 (P)>, <PdbAtom 3230 (P)>}
>>> pdb.get_atom_by_id(23)
<PdbAtom 23 (N)>
The complexes, chains and small molecules of the model exist as sets, and can be queried by ID or name:
>>> pdb.model().chains()
{<Chain B (214 residues)>, <Chain A (204 residues)>}
>>> len(pdb.model().small_molecules()) # Includes solvent molecules
184
>>> pdb.model().get_chain_by_id("B")
<Chain B (214 residues)>
>>> pdb.model().get_small_molecules_by_name("XMP")
{<SmallMolecule (XMP)>, <SmallMolecule (XMP)>}
Note
PDB files are not always perfect representations of the real molecular structures they are created from. Sometimes there are missing atoms, and sometimes there are missing residues. For this reason molecuPy draws a distinction between present and missing atoms, and present and missing residues. See the full API docs for more details.
Chains¶
A Chain object is an ordered sequence of Residue objects, and
they are the macromolecular structures which constitute the bulk of the model.
>>> pdb.model().get_chain_by_id("A")
<Chain A (204 residues)>
>>> pdb.model().get_chain_by_id("A").chain_id()
'A'
>>> pdb.model().get_chain_by_id("A").residues()[0]
<Residue (VAL)>
Chains inherit from ResiduicStructure and
ResiduicSequence and so have methods for retrieving residues:
>>> pdb.model().get_chain_by_id("A").get_residue_by_id("A23")
<Residue (ASN)>
>>> pdb.model().get_chain_by_id("A").get_residue_by_name("ASP")
<Residue (ASP)>
>>> pdb.model().get_chain_by_id("A").get_residues_by_name("ASN")
{<Residue A5 (ASN)>, <Residue A23 (ASN)>, <Residue A23A (ASN)>, <Residue A10
1(ASN)>, <Residue A141 (ASN)>, <Residue A199 (ASN)>}
>>> pdb.model().get_chain_by_id("A").sequence_string()
'VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICR
ATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRP
ERLSRLREIIGQDSFLISPGGETLRFADAIIVGRSIYLADNPAAAAAGIIESI'
Like pretty much everything else in molecuPy, chains are ultimately atomic structures, and have the usual atomic structure methods for getting mass, retrieving atoms etc.
The Residue objects themselves are also atomic structures, and
behave very similar to small molecules. They have downstream_residue and
upstream_residue methods for getting the next and previous residue in
their chain respectively.
Small Molecules¶
Many PDB files also contain non-macromolecular objects, such as ligands, and
solvent molecules. In molecuPy, these are represented as
SmallMolecule objects.
There’s not a great deal to be said about small molecules. They are atomic structures, so you can get their mass, get atoms by name/ID etc.
>>> pdb.model().get_small_molecule_by_name("BU2")
<SmallMolecule A500 (BU2)>
>>> pdb.model().get_small_molecule_by_name("XMP").atoms()
{<PdbAtom 3240 (C)>, <PdbAtom 3241 (N)>, <PdbAtom 3242 (N)>, <PdbAtom 3243 (
C)>, <PdbAtom 3244 (O)>, <PdbAtom 3245 (C)>, <PdbAtom 3246 (O)>, <PdbAtom 32
47 (C)>, <PdbAtom 3248 (N)>, <PdbAtom 3249 (C)>, <PdbAtom 3250 (C)>, <PdbAto
m 3251 (O)>, <PdbAtom 3252 (C)>, <Atom 3253 (O)>, <PdbAtom 3230 (P)>, <PdbAt
om 3231 (O)>, <PdbAtom 3232 (O)>, <PdbAtom 3233 (O)>, <PdbAtom 3234 (O)>, <P
dbAtom 3235 (C)>, <PdbAtom 3236 (C)>, <PdbAtom 3237 (O)>, <Atom 3238 (C)>, <
PdbAtom 3239 (N)>}
>>> pdb.model().get_small_molecule_by_name("XMP").get_atom_by_id(3252)
<PdbAtom 3252 (C)>
The BindSite binding site of the molecule, if there is one, can be
determined in one of two ways. If the PDB file already defines the site, it can
be found with:
>>> pdb.model().get_small_molecule_by_name("XMP").bind_site()
<BindSite AC3 (11 residues)>
If there isn’t one defined, you can try to predict it using atomic distances:
>>> pdb.model().get_small_molecule_by_name("XMP").predict_bind_site()
<BindSite CALC (5 residues)>
All atomic structures can do this, but it is perhaps most useful with small molecules.
Atoms¶
PDB structures - like everything else in the universe really - are ultimately
collections of Atom - Atom - objects. They possess a few key
properties from which much of everything else is created:
>>> pdb.model().get_atom_by_id(28)
<PdbAtom 28 (C)>
>>> pdb.model().get_atom_by_id(28).atom_id()
28
>>> pdb.model().get_atom_by_id(28).atom_name()
'CB'
>>> pdb.model().get_atom_by_id(28).element()
'C'
>>> pdb.model().get_atom_by_id(28).mass()
12.0107
molecuPy draws a distinction between generic atom objects, and
PdbAtom objects, which have coordinates. These are the atoms
listed in the PDB file as being observed in the experiment that produced it.
Why the distinction? PDB files also list missing atoms - atoms known to be
present in the structure depicted but which were not observed in the data. For
those the generic Atom class is used.
There are also missing residues, which are represented here as ordinary
residues composed entirely of missing atoms. All residues have a
is_missing method to make this clear.
The distance between any two PDB atoms can be calculated easily:
>>> atom1 = pdb.model().get_atom_by_id(23)
>>> atom2 = pdb.model().get_atom_by_id(28)
>>> atom1.distance_to(atom2)
7.931296047935668
Bonds will be assigned where possible - the bonds between atoms in
standard residues are inferred from atom names, and PDB files contain
annotations for other covalent bonds. These are assigned to the atoms as
Bond objects.
>>> pdb.model().get_atom_by_id(27).bonds()
{<Bond between Atom 27 and Atom 101>, <Bond between Atom 100 and Atom 27>}
The atoms directly bonded to any atom can be obtained with
bonded_atoms, and the set of all atoms that are accessible is accessed
with accessible_atoms.
>>> pdb.model().get_atom_by_id(3201)
<PdbAtom 3200 (P)>
>>> pdb.model().get_atom_by_id(3201).bonded_atoms()
{<PdbAtom 3200 (P)>}
>>> pdb.model().get_atom_by_id(3200).bonded_atoms()
{<PdbAtom 3203 (O)>, <PdbAtom 3201 (O)>, <PdbAtom 3204 (O)>, <PdbAtom 3202 (
O)>}
>>> pdb.model().get_atom_by_id(3200).accessible_atoms()
{<PdbAtom 3214 (O)>, <PdbAtom 3215 (C)>, <PdbAtom 3216 (O)>, <PdbAtom 3217 (
C)>, <PdbAtom 3218 (N)>, <PdbAtom 3219 (C)>, <PdbAtom 3201 (O)>, <PdbAtom 32
20 (C)>, <PdbAtom 3202 (O)>, <PdbAtom 3221 (O)>, <PdbAtom 3203 (O)>, <PdbAto
m 3222 (C)>, <PdbAtom 3204 (O)>, <PdbAtom 3223 (O)>, <PdbAtom 3205 (C)>, <Pd
bAtom 3206 (C)>, <PdbAtom 3207 (O)>, <PdbAtom 3208 (C)>, <PdbAtom 3209 (N)>,
<PdbAtom 3210 (C)>, <PdbAtom 3211 (N)>, <PdbAtom 3212 (N)>, <PdbAtom 3213 (
C)>}
Similarly, all atoms have a model method which refers back to their Model,
and as long as this is the case, they can use their local_atoms method to
return a set of all atoms within a given distance.
>>> pdb.model().get_atom_by_id(3201).local_atoms(5) # Atoms within 5A
{<PdbAtom 3214 (O)>, <PdbAtom 3215 (C)>, <PdbAtom 3216 (O)>, <PdbAtom 3217 (
C)>, <PdbAtom 3218 (N)>}
Binding Sites¶
BindSite objects represent binding sites. They are residuic
structures, with the usual residuic structure methods, as well as a ligand
property.
>>> pdb.model().sites()
{<BindSite AC2 (5 residues)>, <BindSite AC1 (4 residues)>, <BindSite AC4 (11
residues)>, <BindSite AC3 (11 residues)>}
>>> pdb.model().get_site_by_id("AC1").residues()
{<Residue A10 (ASP)>, <Residue A11 (LEU)>, <Residue A34 (LYS)>}
>>> pdb.model().get_site_by_id("AC1").ligand()
<SmallMolecule A1000 (BU2)>
Secondary Structure¶
Chain objects have a alpha_helices property and a
beta_strands property, which are sets of AlphaHelix objects
and BetaStrand objects respectively.